PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 133aa    MW: 14716.5 Da    PI: 7.148
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019338genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.7e-4071061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC++dC+++pyfp+++p++f +vh+++Gasn+ k+lk+lp + r da++sl++eA+ r  dPvyG+vg+i++l+++++ +++ela+++
  DCAR_019338   7 RCAACKYLRRKCPSDCIFSPYFPSDDPQRFSCVHRIYGASNIGKMLKQLPVQLRADAANSLYFEAHSREADPVYGCVGIITNLNEEIHDAETELAKIQ 104
                  6**********************************************************************************************999 PP

       DUF260  99 ee 100
                  ++
  DCAR_019338 105 AH 106
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5196107IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-397104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MTSTRSRCAA CKYLRRKCPS DCIFSPYFPS DDPQRFSCVH RIYGASNIGK MLKQLPVQLR  60
ADAANSLYFE AHSREADPVY GCVGIITNLN EEIHDAETEL AKIQAHIGVH HQTKNPEDGE  120
ASQSGHSPVQ QQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025110.15e-55PREDICTED: LOB domain-containing protein 24-like
SwissprotP594683e-49LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A059DJZ96e-55A0A059DJZ9_EUCGR; Uncharacterized protein
STRINGPOPTR_0012s13910.13e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-50LOB domain-containing protein 24